Het is al twintig jaar algemeen bekend dat een nieuwe stam van het coronavirus vroeg of laat een pandemie zou gaan veroorzaken. De huidige coro-nacrisis was te voorzien en ze werd al jarenlang verwacht. Waarom werd er dan geen actie ondernomen door regeringen en het WHO?

Coronavirussen zijn bekende luchtwegvirussen. Ze zijn de oorzaak van de meeste verkoudheden. In het algemeen zijn ze niet dodelijk. Toch kunnen ze ontsporen en een gevaar voor de volksgezondheid gaan vormen. De stam SARS-CoV was de eerste die ontspoorde en een bedreiging werd. Tijdens mijn bezoek in 2003 aan een congres van longspecialisten in Australië was er speciale aandacht voor SARS-CoV, dat destijds een ernstig ademhalingssyndroom (SARS) veroorzaakte. SARS had een sterftecijfer van 9 procent en werd gezien als een serieus gevaar voor de westerse samenleving. Gelukkig was SARS niet zo besmettelijk als gevreesd. Binnen enkele maanden was het virus verdwenen. Toch wist elke longspecialist dat dit niet het laatste dodelijke coronavirus zou zijn.

In 2012 stak het volgende coronavirus, MERS-CoV, de kop op. Met een sterftecijfer van boven de 30 procent was dit het meest agressieve coronavirus tot nu toe. Ook dit virus verdween weer zonder een pandemie te veroorzaken. Opnieuw wisten longspecialisten dat dit ook niet het laatste dodelijke coronavirus zou zijn.

Sinds 2019 is er het SARS-CoV2, het coronavirus dat Covid-19 veroorzaakt. Het heeft de pandemie veroorzaakt waar destijds iedereen bang voor was. Met een sterftecijfer van gemiddeld 3 tot 4 procent is SARS-CoV2 niet zo dodelijk als eerdere coronavirussen, maar wel veel besmettelijker. Daarom is het gevaarlijk voor de zwaksten van onze samenleving.

RNA-virus

Coronavirussen zijn RNA-virussen. Ze vinden hun oorsprong in het genoom van hogere organismen. Nieuwe stammen ontstaan voortdurend door recombinatie van RNA. Momenteel kennen we zeven soorten die de mens kunnen infecteren. Bij besmetting ontwikkelt de mens luchtweginfectiesademhalingssymptomen van verschillende ernst. Twee types, HCoV-229E en HCoV-OC43, veroorzaken verkoudheid. De andere coronavirussen kunnen leiden tot ernstigere luchtweginfecties en kunnen zelfs dodelijk zijn.

Tussen de uitbraak van SARS in 2003 en de uitbraak van Covid-19 ligt zeventien jaar. In deze jaren zagen Facebook, Snapchat en Amazon het licht. Virtual Reality, kunstmatige intelligentie en ”machine learning” werden ontwikkeld. Het menselijk DNA werd in kaart gebracht, evenals het genoom van meer dan 250 andere organismen. De genomen van honderden virussen, waaronder alle coronavirussen, werden eveneens ontrafeld en in kaart gebracht. Bovendien werd de genbewerkingstechnologie CRISPR-Cas ontwikkeld.

In zeventien jaar tijd zijn veel hightech-gadgets en technologieën ontwikkeld. Maar waar bleef in deze jaren een adequate behandeling tegen coronavirussen? Is er een vaccin ontwikkeld? Of een antilichaam? Alle kennis om dat te doen was aanwezig. En we wisten dat er een nieuwe uitbraak van het coronavirus zou komen, waarschijnlijk in China. Het schokkende feit is dat er niets is ontwikkeld om de volgende uitbraak van een dodelijk coronavirus te bestrijden. Helemaal niets!

Duizenden mensen stierven tijdens de corona-epidemieën van 2003 en 2013, omdat er verrassend genoeg geen vaccin, behandeling of diagnose was ontwikkeld. Anno 2020 doodt een coronavirus opnieuw duizenden mensen. Zeker, er is nu een diagnostische test beschikbaar. Maar een vaccin of behandeling is er nog steeds niet.

Het is bijna ongelooflijk. We kunnen ons echt afvragen waarom onze regeringen, onder leiding van de WHO, geen onderzoeks- en ontwikkelingsprogramma hebben opgezet om voorbereid te zijn op deze uitbraak. Dat zou geen grote wetenschappelijke opgave zijn geweest, en ook niet erg kostbaar.

Eiwitten

Alle dodelijke coronavirussen hebben zeer vergelijkbare moleculaire structuren. Hun virale genoom codeert voor verschillende eiwitten met unieke functies, waaronder een N-eiwit en een spike (S)-eiwit. Het N-eiwit, dat in alle agressieve coronastammen voorkomt, wordt momenteel gebruikt als een diagnostische ”marker”. Het S-eiwit is het beste doelwit bij de ontwikkeling van vaccins en virus-remmende antistoffen, omdat het S-eiwit nodig is om de cellen van het menselijk lichaam binnen te dringen.

Nieuwe studies hebben aangetoond dat Covid-19 dezelfde ACE2-receptor gebruikt om menselijke cellen te infecteren als het SARS-virus van 2003. Een op ACE2 gebaseerde behandeling voor SARS zou dus een behandeling voor Covid-19 zijn geweest. Tenminste, als die zou zijn ontwikkeld.

Net als SARS en MERS is Covid-19 een onaangename wake-up call voor onze slapende regeringen. Die hadden al lang geleden hun verantwoordelijkheid moeten nemen. Er was immers volop gelegenheid om behandelingen en vaccins te ontwikkelen om de Corona-crisis, die in feite zeventien jaar geleden is begonnen, te voorkomen.

Als ze naar coronadeskundigen hadden geluisterd, was er nu een oplossing geweest. Als ze enkele miljoenen hadden besteed aan preventief en curatief onderzoek, zou de wereld voorbereid zijn geweest op de coronacrisis. Sterker nog, er zou geen coronacrisis zijn geweest. Kennelijk hebben onze overheden ervoor gekozen om de ogen hiervoor te sluiten en het leven van duizenden mensen op het spel te zetten. Ze nemen zelfs het faillissement van het economische systeem op de koop toe. Maar het leven van de slachtoffers kan niet met geld worden vergoed.

Dit artikel is met toestemming overgenomen uit het Reformatorisch Dagblad. De volledige bronvermelding luidt: Borger, P., 2020, Overheden waren te laks rond corona, Reformatorisch Dagblad 49 (308): 18-19 (Artikel).

LEUK ARTIKEL?
Bent u blij met dit artikel? Het onderhoud en de ontwikkeling van deze website vragen financiële offers. Zou u ons willen steunen met een maandelijkse bijdrage? Dat kan door ons donatieformulier in te vullen of een bijdrage over te schrijven naar NL53 INGB000 7655373 t.n.v. Logos Instituut. Logos Instituut is een ANBI-stichting en dat wil zeggen dat uw gift fiscaal aftrekbaar is.

Peter Borger

Written by

Peter Borger is moleculair bioloog, specialist in signaaltransductienetwerken en genregulatie-systemen, tevens auteur van Terug naar de Oorsprong. Hij is één van de grensverleggende wetenschappers binnen de nieuwe biologie. Daarin staat onder meer centraal dat soortenvorming daadwerkelijk plaatsvindt, omdat het genoom daarvoor is geprogrammeerd, maar dat alle verschillende soorten niet allemaal dezelfde voorouder hebben. Ook wordt vanuit deze tak van de biologie duidelijk dat er geen genetische informatie-toename nodig is om nieuwe soorten voort te brengen. Alle informatie om nieuwe soorten te vormen was reeds aanwezig in het genoom vanaf de tijd dat de oervormen werden geschapen.

1 Comment

Comments are closed.